PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S06621.10
Common NameJCGZ_23923, LOC105645472
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family Nin-like
Protein Properties Length: 145aa    MW: 17294.5 Da    PI: 4.2829
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S06621.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK52.68.7e-17109145541
         RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGI 41 
                    +++e+++kyF+lpi++AAke++v+lTvLK++CR+++I
  Jcr4S06621.10 109 LEMEEIKKYFDLPITKAAKEMNVGLTVLKKRCRELNI 145
                    789*******************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151910.63791145IPR003035RWP-RK domain
PfamPF020422.5E-13109145IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MDSKRTDQEL LLNIPKNEYS FDTDWLNLDD TFQKVSEFPP LESFFELDSL TLPHYKNYGF  60
EGFEEINLDI DDYSFLDSTL LLDNPYDRYC ENVEEERRLR NGRKMSVPLE MEEIKKYFDL  120
PITKAAKEMN VGLTVLKKRC RELNI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012086468.11e-102PREDICTED: protein RKD4
TrEMBLA0A067JSK11e-102A0A067JSK1_JATCU; Uncharacterized protein
STRINGPOPTR_0012s02390.15e-19(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.13e-15RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]